PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000237.1.g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family DBB
Protein Properties Length: 256aa    MW: 27361.7 Da    PI: 5.1262
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000237.1.g00007.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.81.6e-06447542
                        zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                                     C+ +e  e++  C  ++  lC  C ++ H        H++vpl
  FANhyb_rscf00000237.1.g00007.1  4 QCNVCETSEATVLCCADEAALCWACDEKVHAAnklaskHQRVPL 47
                                    7******99*********************66899999999986 PP

2zf-B_box28.14.2e-095284335
                        zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHk 35
                                     +kC+ ++e    +fC +++ llC++C +++H 
  FANhyb_rscf00000237.1.g00007.1 52 LPKCDICQEAVGYFFCLEDRALLCRKCDVAIHT 84
                                    589*******9*********************3 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.68147IPR000315B-box-type zinc finger
CDDcd000218.63E-7347No hitNo description
SMARTSM003366.0E-10447IPR000315B-box-type zinc finger
PfamPF006431.5E-5447IPR000315B-box-type zinc finger
SMARTSM003366.2E-165097IPR000315B-box-type zinc finger
PROSITE profilePS501199.0015097IPR000315B-box-type zinc finger
CDDcd000212.74E-85397No hitNo description
PfamPF006433.2E-75393IPR000315B-box-type zinc finger
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009641Biological Processshade avoidance
GO:0009658Biological Processchloroplast organization
GO:0009718Biological Processanthocyanin-containing compound biosynthetic process
GO:0010099Biological Processregulation of photomorphogenesis
GO:0015995Biological Processchlorophyll biosynthetic process
GO:0016607Cellular Componentnuclear speck
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MKIQCNVCET SEATVLCCAD EAALCWACDE KVHAANKLAS KHQRVPLSAS HLPKCDICQE  60
AVGYFFCLED RALLCRKCDV AIHTVNSFVS GHRRFLLTGI KVGLEPNPPG GSGSGGGVAG  120
SSSSVKSESG AVAKCEGNNQ LAEECKVAPE SVAGMGFSGG SGGWADCGKL GDSDSSVLRS  180
SEEELEDYEC IGQVPELSWM VPQVPSPPTS SGLYWPKTYQ NPLDSAVFVP DVNYSDMQNS  240
LHYQQNGTVS KRRRQF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004294165.11e-151PREDICTED: B-box zinc finger protein 22
TrEMBLD9ZIW31e-126D9ZIW3_MALDO; COL domain class transcription factor
STRINGSolyc07g062160.2.11e-104(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45663453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78600.13e-62light-regulated zinc finger protein 1